Free Text Transliteration Tool | Learn online Punjabi Typing | DoTyping.com
Web Based Online Text Translitertion Tool to many Languages. On the go and easy to use switiching of transliteration between different languages.
Stats
Alexa Rank:
Popular in Country:
Country Alexa Rank:
language: en-US
Response Time: 0.919172
SSL: Enable
Status: up
Code To Txt Ratio
Word Count 406
Links
ratio 4.8251903867075
SSL Details
SSL Issuer:
Issuer: Cloudflare Inc ECC CA-3
Valid From: 2022-05-11 00:00:00
Expiration Date: 2023-05-10 23:59:59
SSL Organization:
Signature 9ebe42241788f2c7b0cb84418f2b951c327cd7c9
Algorithm: ecdsa-with-SHA256
Found 74 Top Alternative to Dotyping.com
Typepunjabi.com
Home | Raavi Font Typing Tutor | Learn Free Raavi Typing | TypePunjabi.Com
Learn Punjabi Typing in Raavi font for free using TypePunjabi.com. Exercises are updated regularly. Helpful to prepare for typing tests for Government Jobs. Specially designed for easy use. Shows Net Words per Minute. Free Punjabi Tutor Practice software at TypePunjabi
103.21.58.244
United States
Valid SSL
Akhartk.com
Raavi Font Typing Tutor | Learn Free Raavi Typing | www.akhartk.com
Learn Punjabi Typing in Raavi font for free using Akhartk.com website. Exercises are updated regularly. Helpful to prepare for typing tests for Government Jobs. Specially designed for easy use. Shows Net Words per Minute. Free Punjabi Tutor Practice software at Akhartk.com
Piousinfotech.com
Welcome to our Piousinfotech.com - DCA,Website Developmet,Solidworks,Staad Pro,AutoCAD training center in patiala
PIOUS INFOTECH ACADEMY is an authorized training center to develop websites and provide training in AutoCAD, Solidworks, Staad Pro,catia and other engineering software.
Typingguru.in
Typing Tutor Software for Hindi Punjabi
online typing tutor master test software for hindi remington gail, krutidev font, punjabi raavi, asees font and english. Practice with online typing master
Missionsarkarinaukri.com
Mission Sarkari Naukri - Government Job, Test, Result, Paper, Study Note etc Mission Sarkari Naukri
Punjab Chandigarh Haryana Himanchlpardesh Delhi Goverment and Contract Jobs Result Admit Card and other Notes, Raavi punjabi typing English typing PSSSB Typing Demo chunk paragraph typing line practice raavi symboles code typing tips
Govtexamsadda.blogspot.com
Govt Exams Adda
Current Affairs quiz for ALL Exams: GovtExamsAdda Current Affairs is best for all exams. Current affairs, Latest jobs, 2014, General Knowledge 2015,
Wordpress.com
WordPress.com: Fast, Secure Managed WordPress Hosting
Create a free website or build a blog with ease on WordPress.com. Dozens of free, customizable, mobile-ready designs and themes. Free hosting and support.
Shriwaheguru.com
Type Punjabi online, easily.
Waheguru, Gurmukhi, How to type Punjabi, How to write Punjabi, How to type Gurmukhi, How to write Gurmukhi, Virtual Punjabi Keyboard, Online Punjabi Keyboard,Punjabi keyboard, Online Punjabi Keyboard, Web Punjabi Keyboard, Virtual Punjabi Keyboard, Panjabi keyboard, Online Panjabi Keyboard, Virtual Panjabi Keyboard, Web Panjabi Keyboard
Knowledgebite.blogspot.com
Knowledge Bite
Sharing Knowledge with evryone. Punjabi Raavi Font Keyboard, Unicode, keyboards, c programs, C Language, Asees Font Keyboard, Joy Font Keyboard,
Estudytech.blogspot.com
Estudytech
all types of technology, study, civil engineering, competitive exam information here
Punjabitutor.com
Punjabi Tutor - Home
Punjabi Classes Experienced, friendly, university graduate, and native speaker of Punjabi will teach you this popular, rich language in a very efficient manner. You will learn a lot of Punjabi in a short time. I have 12 years Punjabi teaching experience. I offer a fast, efficient way for English speakers...
Unicodepoint.net
Unicodepoint
Online free typing tutor and mock test paragraph. learn typing and practices also track your typing progress. especially designed for punjab state level typing test preparations. you can also get more than typing on unicodepoint blog.
Punjabishorthand.com
Punjabi Shorthand
Get Latest Punjabi shorthand dictations, Punjabi shorthand notes, English shorthand dictations, Court dictations & Shorthand outlines
Myonlinedigitalclassroom.blogspot.com
Digital Gyan
A blog for developing technical skill and learning online. IT tutorials, learn , earn money, lyrics, stories, quiz, typing, poetry, jokes, quotes etc.
Everythingeasywithme.blogspot.com
Everything Easy with Me
PSSSB, punjabi, raavi font, wpm, increase typing speed, raavi font typing, mock test, raavi punjabi, online punjabi typing, unicode raavi font
Onlinetyping.in
English and Hindi typing speed test & typing practice app
Award winning English & Hindi typing speed test online portal to practice typing. Bengali, Gujarati, Marathi & other 15 Indian languages typing app.
Punjabjobportal.com
Punjab Job Portal - Govt Jobs|Punjab Jobs| Latest Interview
Punjab Job Portal, Punjab Govt Jobs, Sarkari Naukri Punjab, Punjab, Jobs, Haryana Jobs, Punjab State Govt Jobs, University Jobs, Data Entry jobs Punjab, Clerk job Punjab, etc.
Hartronexam.com
Home | HARTRON EXAM
Free Computer Basic Course Tutorials, Hartron Free Typing Lesson, Computer Parts Name Complete Information, Hartron Exam Syllabus Question, Hartron Important.
Gatewaysolu.blogspot.com
Gateway Solutions- Networking, Hardware & Security
Online Platform for tutorials on Computer hardware Repair , Networking , softwares , Programming languages , ethical hacking , Accounts tally GST and
Proinfopoint.blogspot.com
Neobit Media
This website is about computer, internet and latest technics, where you will find computer tech related information in very easy language.
Easypunjabityping.com
FREE Punjabi Typing | English to Punjabi Translation ← ਪੰਜਾਬੀ ਵਿਚ ਦੀ ਕਿਸਮ
ਪੰਜਾਬੀ ਵਿਚ ਦੀ ਕਿਸਮ - FREE Punjabi typing and translation software. Use our ONLINE tool to type in Gurmukhi using English alphabets. For E.g. typing
Khilare.com
Khilare- Current Affairs, Punjabi Typing, English Typing, Job Alerts, Govt. jobs
Punjabi typing, English typing, Free download Current Affairs pdf Magazine, Daily quiz, LATEST GOVERNMENT JOBS, Previous Question Papers, upsc, ssc
Typingpoint.com
Typing Point | All Languages Typing Portal
In Typing Point you will find typing software in all languages. with the help of which you can easily learn to type in your own language.
Merityping.com
MeriTyping - Check your typing speed in Hindi & English
hasassuremustnexttheirhighgirlduringdoneagainstslowthoughschoolgroupmustdogstudyagemountainsincegroundnumberbetweentreelotthissurewhatfootwhynumeralspellablerananimalbusywonderdirectclearcheckshapebyvoiceeachschoolwoodyesperhapssizecoverseaandgreatportliveweredrawfamilycansingstandardhomemesitthinghearpatternyetwhitemindwerepicturemenfarthisfoursidebeautylistennorthdrawafterwatereasewhiletruereachdryhorsenextwondermelightreadysecondvoicehotfoundcheckliveweekstaterightnumberplainlearntreemorerockcarrycoldbringeatupoftenquickturnbasedeepsayplantbringneedoncemapsidefirstwoodmorninggreatwatchcoldcityhighuntilplanperhapsanyleavegameholdservesimplebeginseconddonespecialsetfishbegindidwehomenevermilefirstpullinchthroughallwhenpeopleroadownpaintwhitebigmanproductrockreadpieceaftercorrectcitywritesevendeeptogetherpatternatsomewayspellleftnotenumberrunsimplenorthyournightnotesleepoffkingeightuseobjectsentencedrivetellclasspoundstillrunboylessmoondon'tproblemsnowwhyoncewindpeoplefirstinchclassflytalkifeaselayfirsttimemooneasewaitthenslowtreethousandagainpaintwindtellcomedryusualwhitefishnountoldcauseearlybegingirlstudycoldsetbeganenoughleaveteachairbookshipdon'tmarklearnalwaysfireoldwespeedyearmakelittlemuchwhodecideroadheatableanswerbeforewoodanfeetoverbirdfigureyesnightbeginmemainrecordbirdkingbetweenlaughwaywantwatchgirluslaugh
Easytotranslate.com
Easytotranslate.com:Translate English to Hindi
Online Translate English to Hindi Website - Free Hindi Site for Translating English to Hindi. Typing 'Best Hindi Typing' will translate it into 'बेस्ट हिंदी टाइपिंग'.
Typingboss.com
Home
Your Modules Details Written by: Joomla Category: Blog Published: 09 September 2021 Hits: 1021 Millions Worldwide Love Joomla 4 Your site has some commonly used modules already preconfigured. These include: Image Module which holds the image beneath the menu. This is a Custom module that you can edit to change...
Gurmukhifontconverter.com
Gurmukhi font converter
Punjabipedia App ਪੰਜਾਬੀਪੀਡੀਆ ਐੱਪ : ਗਿਆਨ ਤੁਹਾਡੀ ਮੁੱਠੀ ਵਿੱਚ How to Use Punjabipedia ਪੰਜਾਬੀ ਭਾਸ਼ਾ ਸਾਹਿਤ ਅਤੇ ਸੱਭਿਆਚਾਰ ਤੋਂ ਇਲਾਵਾ ਹੋਰ ਗਿਆਨ ਵਿਗਿਆਨ ਦੇ ਰੂਬਰੂ ਹੋਣ ਲਈ ਪੰਜਾਬੀਪੀਡੀਆ ਐਪ ਡਾਊਨਲੋਡ ਕਰੋ ..... Read More... ਬਤੌਰ ਵਿਦਿਆਰਥੀ ਗੂਗਲ ਕਲਾਸਰੂਮ ਦੀ ਵਰਤੋਂ How to Use Google Classroom as students ਪਿਛਲੀ ਵੀਡੀਓ "ਗੂਗਲ...
Typingway.com
Typingway - Your way to success
Get premium study material and regular job updates. We provide free premium study material and preparation stratagy for exams like UPSC, SSC, Patwari, LDC
Typingwala.com
Typingwala - Speed up your typing skills
typing, english typing, hindi typing, learn typing, mangal typing, kruti typing,
Typingvidya.com
Typing Vidya - Typing Tutors | Typing Test | Language Converter | Font Converter
Typing Vidya - Online Store for Buying Indian Languages Utility Software, All Indian Languages Software Available for Download and Install on your Desktop, Typing Software for Hindi, Marathi, Bengali, Punjabi, Oriya, Malayalam, Kannada, Tamil, Telugu, Gujarati, Mangal, Unicode, Typing Tutor software free download, Typing Test software free download
Ntstypingtest.blogspot.com
NTS ONLINE TYPING TEST
English Essay on Patriotism Admin April 01, 2018 Patriotism means love for and devotion to one's mother-land. This is a very natural aspect of 'human life. We naturally have some a... By Admin at April 01, 2018 0 comments Email ThisBlogThis!Share to TwitterShare to Facebook Labels: Essay Load Shedding of...
Gcctyping.com
Agrawal and Sons (Ascorp Technoart)
MS-CIT Suite (PC) With updated Practical MCQ, Theory MCQ and Practical Questions as per latest 2021 syllabus. View DetailsDownload Free Trial MS-CIT Suite (Android) With updated Theory and Practical MCQ Questions as per latest 2021 syllabus. View DetailsDownload Free Trial GCC-TBC Suite (PC) The only suite in the market with...
Fast-typing.com
English ✔️ Typing Speed Test
ENGLISH typing speed test is a free typing tutor for beginner and advanced to practice typing. ENGLISH typing speed tester to check your typing speed and accuracy, its fully free. use & enjoy ...!
Vacancyexam.com
Vacancy Exam | Latest Job Notifications
Reasoning Questions Tips and Tricks || How to Download and Install Raavi Font || How to Join Indian Air Force || Most Important Punjab GK MCQs || Punjab
Akhariwp.com
Akhar 2021- Indic Word Processor
ਅੱਖਰ - 2021 Akhar 2021 Download ਅੱਖਰ ਇੰਡੀਕ ਵਰਡ ਪ੍ਰੋਸੈਸਰ ਸ਼ਬਦ ਸਵੈ-ਪੂਰਨਤਾ ਦੀ ਟਾਈਪਿੰਗ ਸਹੂਲਤ ਬਹੁ-ਭਾਸ਼ਾਈ ਫਜ਼ੀ ਸਰਚ ਲਿਪੀ ਵਿਆਕਰਨ ਸਹੂਲਤ ਸ਼ਬਦ-ਜੋੜ ਨਿਰੀਖਕ ਦੀ ਜਾਂਚ ਵਿੱਚ ਸੁਧਾਰ ਟਾਈਪ ਕਰਦੇ ਸਮੇਂ ਸ਼ਬਦ-ਜੋੜਾਂ ਦੀ ਜਾਂਚ ਆਟੋ ਦਰੁਸਤ ਕਰਨਾ ਭਾਸ਼ਾਈ ਸਰੋਤ: ਅਗੇਤਰ, ਪਿਛੇਤਰ, ਥੀਸੌਰਸ Intelligent font conversion Font to Unicode font conversion facility...
Smarttyping.com
Home - smarttyping.com
+316.5439.8521Questions? Contact UsBy e-mail LinkedInVimeo HOME ABOUT COURSESNEW CoursesINFO What is SmartTyping! wherever you areONLINE Application Process EducationTEACHERS & STUDENTS What is SmartTyping Medics Business Students APPLY BusinessApply Apply for Business MedicsApply Apply for Medics StudentsApply Apply for Students APPLY Act now TODAY REVIEWS FACILITIES CONTACT US NEWS Loading... As...
Rkcomputercentre.com
R.K Computer Courses Ludhiana Punjab - R.K.Computer Centre (Regd.)
R. K. Computer Centre (Regd.) is one of the biggest ISO Training Institute Ludhiana Punjab established in 1992 is ISO 9001:2015 certified.
Eazytyping.com
Type in Hindi - Eazy Typing - Online typing tool
An Online and Mobile Hindi conversion, translation and Hindi typing tool powered by google. Share and post Hindi in facebook and twitter, A tool for Hindi Typing and Hindi Conversion in Android Mobile, Apple IPhone and Desktop as well. Our typing tool supported languages are Malayalam, Arabic,Bengali,Chinese,Gujarati,Hindi,Kannada,Marathi,Nepali,Oriya,Persian,Punjabi,Tamil,Telugu etc
Ps205.org
PS 205Q Alexander Graham Bell – When the Bell Rings – The Learning Begins.
PS 205Q ROCKS!!! Welcome Alexander Graham Bell School PS 205Q 75-25 Bell Blvd Bayside, NY 11364 Phone: (718) 464-5773 Fax: (718) 464-5875 Mrs. Karen Scott-Piazza Principal Mission Statement Our Mission is to: Provide children with a quality education by implementing high academic standards Provide the broadest opportunities for each student...
Stjschoolwilliston.com
St. Joseph's Catholic School | Pre-K to Grade 6 Catholic School | Williston, ND
St. Joseph Church and School in Williston North Dakota. Parish includes St. John the Baptist Church in Trenton, and St. Boniface in Grenora. Mass and confession times, sacraments, liturgy, pre-k to grade 6 Catholic School.
Hinditypingtutor.co.in
Hindi Typing Tutor Mangal Free Download and Online
Hindi Typing Tutor Mangal Free and Hindi Typing Test inscript online, Unicode fonts Hindi Typing Learning, Govt exam typing practice and Download
Socialtypingtest.com
Free Online Typing Speed Test In English 1 to 5 minutes
Free online typing speed test master software application job challenge 5 minutes certificate words per minute WPM
Antisoftindia.com
Software And Website Development | Coaching Centre | Bulk SMS
Illustrator: Software And Website Development | Coaching Centre | Bulk SMS, Category: Software And Website Development | Coaching Centre | Bulk SMS, Address: Software And Website Development | Coaching Centre | Bulk SMS, City: Sri Muktsar Sahib, Location: Sri Muktsar Sahib
Ilovetyping.com
I Love Typing
I love typing website to type in language. You can convert your english keyboard to your regional language. Just type anything & press space to convert typing.
Hinditypingtest.in
Hindi Typing Test Online: Krutidev Typing Test, Typing Test Hindi
Hindi Typing Test Online is free Typing Software for Kruti Dev, Devlys font. Practice Online Hindi Typing Test, Krutidev Typing Test for speed and accuracy.
Hinditypingtutor.in
Hindi Typing Tutor and Typing Test online - Best website
Free Hindi Typing Tutor and Hindi Typing Test for learning Hindi Typing fast and English typing Master.
Onlinetypingtest.net
ONLINE TYPING TEST - Test WPM Speed and Accuracy
Online Typing Test is a free online speed typing test. Activate our special features to improve your WPM (words per minute) speed and accuracy.
Onlinetypingtests.com
Online Typing Test - Improve Your WPM Speed!
Do you think you are a good typer? Find out how fast you are. Teach and Learn Typing, Free! Test & Improve your Typing Speed!
Anophinditypingtutor.com
Anop | Home
Start Typing Practice Instatntly Evaluate your Preparation with Competitors Focus on Tough Words you Feel Save your Time in Typing Practice Type Real Words in Typing Lessons Practice Typing Exam Level Tests
Careerafter.com
Career After – All Sarkari Jobs and Sarkari Result
Do You Need a Brand Ambassador? careerafter June 29, 2022 Uncategorized Comments Creating a brand is one of the most important things we can do as business owners today. It helps give our business a sense of identity for consumers to understand and relate with. If you don’t have one,...
Alllanguagetranslator.com
Free Online Translation | Text Translator | Hindi Typing
It's free online language Google translator, free dictionary, text translator, document conversion, website translation from English to any language.
Englishtohindityping.com
Engish to Hindi Translation | Type in hindi | Hindi Font Download
हिन्दी में टाइप करें - Official Hindi Site to Type in Hindi Online for FREE! Instant English to Hindi Translation. offcial website of engish to hindi translation,Easy Hindi Typing provides two Hindi Typing tools to type in Hindi using English Alphabets PLUS FREE Hindi fonts and Different Hindi Keyboard Layout.
Hindityping.info
English to Hindi | English to Hindi Conversion | Hindi Typing | हिंदी टाइपिंग
Hindityping.info is the Best, Free & Easy Online English to Hindi Converter (हिंदी टाइपिंग), Typing any text from English to Hindi accurately and fastly is very easy here.
Technologies Used by dotyping.com
Dns Records of dotyping.com
A Record: 172.67.165.251 104.21.16.25AAAA Record: 2606:4700:3035::ac43:a5fb 2606:4700:3037::6815:1019
CNAME Record:
NS Record: kara.ns.cloudflare.com clark.ns.cloudflare.com
SOA Record: dns.cloudflare.com
MX Record: _dc-mx.eaa189161402.dotyping.com
SRV Record:
TXT Record:
DNSKEY Record:
CAA Record:
Whois Detail of dotyping.com
Domain Name: DOTYPING.COMRegistry Domain ID: 2162384681_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-09-16T15:20:53Z
Creation Date: 2017-09-13T04:02:15Z
Registry Expiry Date: 2022-09-13T04:02:15Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: CLARK.NS.CLOUDFLARE.COM
Name Server: KARA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-06-15T17:51:48Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.