Home | HARTRON EXAM
Free Computer Basic Course Tutorials, Hartron Free Typing Lesson, Computer Parts Name Complete Information, Hartron Exam Syllabus Question, Hartron Important.
Stats
Alexa Rank:
Popular in Country:
Country Alexa Rank:
language: en-US
Response Time: 0.955164
SSL: Enable
Status: up
Code To Txt Ratio
Word Count 722
Links
ratio 2.8429063706731
SSL Details
SSL Issuer:
Issuer: Cloudflare Inc ECC CA-3
Valid From: 2022-05-30 00:00:00
Expiration Date: 2023-05-30 23:59:59
SSL Organization:
Signature 0c43a016db354cff1852b539b1c5e31be31ee6dc
Algorithm: ecdsa-with-SHA256
Found 57 Top Alternative to Hartronexam.com
Unicodepoint.net
Unicodepoint
Online free typing tutor and mock test paragraph. learn typing and practices also track your typing progress. especially designed for punjab state level typing test preparations. you can also get more than typing on unicodepoint blog.
104.21.79.203
United States
Valid SSL
Typepunjabi.com
Home | Raavi Font Typing Tutor | Learn Free Raavi Typing | TypePunjabi.Com
Learn Punjabi Typing in Raavi font for free using TypePunjabi.com. Exercises are updated regularly. Helpful to prepare for typing tests for Government Jobs. Specially designed for easy use. Shows Net Words per Minute. Free Punjabi Tutor Practice software at TypePunjabi
Merityping.com
MeriTyping - Check your typing speed in Hindi & English
hasassuremustnexttheirhighgirlduringdoneagainstslowthoughschoolgroupmustdogstudyagemountainsincegroundnumberbetweentreelotthissurewhatfootwhynumeralspellablerananimalbusywonderdirectclearcheckshapebyvoiceeachschoolwoodyesperhapssizecoverseaandgreatportliveweredrawfamilycansingstandardhomemesitthinghearpatternyetwhitemindwerepicturemenfarthisfoursidebeautylistennorthdrawafterwatereasewhiletruereachdryhorsenextwondermelightreadysecondvoicehotfoundcheckliveweekstaterightnumberplainlearntreemorerockcarrycoldbringeatupoftenquickturnbasedeepsayplantbringneedoncemapsidefirstwoodmorninggreatwatchcoldcityhighuntilplanperhapsanyleavegameholdservesimplebeginseconddonespecialsetfishbegindidwehomenevermilefirstpullinchthroughallwhenpeopleroadownpaintwhitebigmanproductrockreadpieceaftercorrectcitywritesevendeeptogetherpatternatsomewayspellleftnotenumberrunsimplenorthyournightnotesleepoffkingeightuseobjectsentencedrivetellclasspoundstillrunboylessmoondon'tproblemsnowwhyoncewindpeoplefirstinchclassflytalkifeaselayfirsttimemooneasewaitthenslowtreethousandagainpaintwindtellcomedryusualwhitefishnountoldcauseearlybegingirlstudycoldsetbeganenoughleaveteachairbookshipdon'tmarklearnalwaysfireoldwespeedyearmakelittlemuchwhodecideroadheatableanswerbeforewoodanfeetoverbirdfigureyesnightbeginmemainrecordbirdkingbetweenlaughwaywantwatchgirluslaugh
Typingwala.com
Typingwala - Speed up your typing skills
typing, english typing, hindi typing, learn typing, mangal typing, kruti typing,
Akhartk.com
Raavi Font Typing Tutor | Learn Free Raavi Typing | www.akhartk.com
Learn Punjabi Typing in Raavi font for free using Akhartk.com website. Exercises are updated regularly. Helpful to prepare for typing tests for Government Jobs. Specially designed for easy use. Shows Net Words per Minute. Free Punjabi Tutor Practice software at Akhartk.com
Typingboss.com
Home
Your Modules Details Written by: Joomla Category: Blog Published: 09 September 2021 Hits: 1021 Millions Worldwide Love Joomla 4 Your site has some commonly used modules already preconfigured. These include: Image Module which holds the image beneath the menu. This is a Custom module that you can edit to change...
Ntstypingtest.blogspot.com
NTS ONLINE TYPING TEST
English Essay on Patriotism Admin April 01, 2018 Patriotism means love for and devotion to one's mother-land. This is a very natural aspect of 'human life. We naturally have some a... By Admin at April 01, 2018 0 comments Email ThisBlogThis!Share to TwitterShare to Facebook Labels: Essay Load Shedding of...
Dotyping.com
Free Text Transliteration Tool | Learn online Punjabi Typing | DoTyping.com
Web Based Online Text Translitertion Tool to many Languages. On the go and easy to use switiching of transliteration between different languages.
Onlinetypingtests.com
Online Typing Test - Improve Your WPM Speed!
Do you think you are a good typer? Find out how fast you are. Teach and Learn Typing, Free! Test & Improve your Typing Speed!
Onlinetypingtest.net
ONLINE TYPING TEST - Test WPM Speed and Accuracy
Online Typing Test is a free online speed typing test. Activate our special features to improve your WPM (words per minute) speed and accuracy.
Quicktypingtest.com
1 Minute Free Typing Test with Words
Online 1 minute free typing test with words in English. Learn typing and type faster with our typing tests and free fun online typing games for kids and all kinds of typists.
Typingway.com
Typingway - Your way to success
Get premium study material and regular job updates. We provide free premium study material and preparation stratagy for exams like UPSC, SSC, Patwari, LDC
Socialtypingtest.com
Free Online Typing Speed Test In English 1 to 5 minutes
Free online typing speed test master software application job challenge 5 minutes certificate words per minute WPM
Hinditypingtest.in
Hindi Typing Test Online: Krutidev Typing Test, Typing Test Hindi
Hindi Typing Test Online is free Typing Software for Kruti Dev, Devlys font. Practice Online Hindi Typing Test, Krutidev Typing Test for speed and accuracy.
Thesarkariresults.com.co
Sarkari Result Info - The Sarkari Results
Sarkari Result Info All latest sarkari jobs Results, Answer keys, Admit Cards, online form for various government Sarkari exam, Exam Notification update,
Micatic.com
Micatic – Best Movies & Gaming Blog
Why You Should Avoid Leverage While Trading in Cryptocurrency? February 2, 2022June 28, 2022adminLeave a Comment on Why You Should Avoid Leverage While Trading in Cryptocurrency? The term cryptocurrency started gaining popularity since the price of Bitcoin started increasing. In 2009, for the first time Bitcoin as a virtual currency...
Typedojo.com
Typing Practice for Kids - Learn Touch Typing With TypeDojo
TypeDojo provides typing practice for kids with our free Touch Typing Lessons & Tests. Find yourself Speeding up, getting certificates and experiencing much more!
Thepracticetest.com
The Practice Test: Free Online Typing & Data Entry Tests
Learn to type, type faster, practice for employment tests like the ProveIt or CritiCall data entry exams. Daily practice is the key to increasing your typing speed and accuracy. We have over 100 different typing practice tests and data entry drills to help keep your typing practice interesting.
Sarkariselection.com
Sarkari Selection: Govt Job Alerts & Hindi Mangal Font Typing
Sarkari Selection is #1 Portal for Hindi Mangal Font Typing with All Bank, SSC, Railway, UPSC, Govt Job Alerts, Updates, Admit Card, Results, & Mock Tests.
Toptyper.com
It may not seem like a big deal to you, Typing Text
Best typing test for all languages. Type about It may not seem like a big deal to you, but your typing skills may be placing
Brigthcareers.com
Brigth careers - Sarkari Naukri Govt Jobs Today Employment News
Sarkari Naukri Govt Jobs Today Employment News
Onlinetyping.org
Online Typing Test Free - Typing Practice and Speed Test
It is a online typing test portal, where you can test your typing speed as well as you can type in several languages without installing any software
Hinditypingtutor.co.in
Hindi Typing Tutor Mangal Free Download and Online
Hindi Typing Tutor Mangal Free and Hindi Typing Test inscript online, Unicode fonts Hindi Typing Learning, Govt exam typing practice and Download
Toptypingtest.com
Typing Fast Is All About The Practice | TopTypingTest
The definitive guide to learning to type in a truly fun and practical way with the least effort possible.
Wordpress.com
WordPress.com: Fast, Secure Managed WordPress Hosting
Create a free website or build a blog with ease on WordPress.com. Dozens of free, customizable, mobile-ready designs and themes. Free hosting and support.
Hinditypingtutor.in
Hindi Typing Tutor and Typing Test online - Best website
Free Hindi Typing Tutor and Hindi Typing Test for learning Hindi Typing fast and English typing Master.
Technologies Used by hartronexam.com
Dns Records of hartronexam.com
A Record: 104.21.45.220 172.67.219.130AAAA Record: 2606:4700:3032::6815:2ddc 2606:4700:3032::ac43:db82
CNAME Record:
NS Record: annalise.ns.cloudflare.com ruben.ns.cloudflare.com
SOA Record: dns.cloudflare.com
MX Record: _dc-mx.5f3e6df5034c.hartronexam.com
SRV Record:
TXT Record: v=spf1 a mx include:websitewelcome.com ~all
DNSKEY Record:
CAA Record:
Whois Detail of hartronexam.com
Domain Name: HARTRONEXAM.COMRegistry Domain ID: 2518933190_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: www.bigrock.com
Updated Date: 2022-04-17T07:37:09Z
Creation Date: 2020-04-26T10:41:24Z
Registrar Registration Expiration Date: 2023-04-26T10:41:24Z
Registrar: BigRock Solutions Ltd.
Registrar IANA ID: 1495
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Ram kishan
Registrant Organization:
Registrant Street: village - Balwanti
Registrant City: kaithal
Registrant State/Province: Haryana
Registrant Postal Code: 136027
Registrant Country: IN
Registrant Phone: +91.9812713871
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [email protected]
Registry Admin ID: Not Available From Registry
Admin Name: Ram kishan
Admin Organization:
Admin Street: village - Balwanti
Admin City: kaithal
Admin State/Province: Haryana
Admin Postal Code: 136027
Admin Country: IN
Admin Phone: +91.9812713871
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [email protected]
Registry Tech ID: Not Available From Registry
Tech Name: Ram kishan
Tech Organization:
Tech Street: village - Balwanti
Tech City: kaithal
Tech State/Province: Haryana
Tech Postal Code: 136027
Tech Country: IN
Tech Phone: +91.9812713871
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [email protected]
Name Server: annalise.ns.cloudflare.com
Name Server: ruben.ns.cloudflare.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1-415-349-0015
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2022-06-29T03:58:45Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: BIGROCK
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is BigRock Solutions Ltd..
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.